Pay in 4 interest-free payments of $5.28 Learn more
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Exp Neurol 161:115126 Vereczki V, Martin E, Rosenthal RE, Hof PR, Hoffman GE, Fiskum G (2006) Normoxic resuscitation after cardiac arrest protects against hippocampal oxidative stress, metabolic dysfunction, and neuronal death
doi: 10.1080/15548627.2019.1603547 47 Franco-ObregonAGilbertJA
Making an Informed Decision About Online GLP-1 Purchases Finding affordable access to GLP-1 medications without insurance requires careful research and consideration of multiple factors
Sema Peptide Characteristics Molecular Formula: CHNO CAS Number: 910463-68-2 Amino Acid Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (Note: Sequence includes chemical modifications to enhance half-life and receptor binding) Synonyms: GLP-1(7-37) analog, NN9535,Molar Mass: ~4113.58 g/mol Recommended Storage: Lyophilized powder: Store at -20C or lower for long-term stability Reconstituted solution: Store at 28C for 30-60 days
US$ 27.08
US$ 22.96
US$ 25.73
US$ 21.83
